PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43402.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 415aa    MW: 46448.8 Da    PI: 6.6974
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43402.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.6e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
       KHN43402.1 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

2Myb_DNA-binding46.21.1e-1467110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +++eE+ l++++++ lG++ W+ Ia+ ++ gRt++++k+ w++
       KHN43402.1  67 RGTFSQEEETLIIELHAVLGNR-WSQIAAQLP-GRTDNEIKNLWNS 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.2E-28664IPR009057Homeodomain-like
PROSITE profilePS5129418.926961IPR017930Myb domain
SuperFamilySSF466891.76E-2912108IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002493.0E-151461IPR001005SANT/Myb domain
CDDcd001671.0E-111761No hitNo description
PROSITE profilePS5129425.40762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2565116IPR009057Homeodomain-like
SMARTSM007174.1E-1366114IPR001005SANT/Myb domain
PfamPF002491.7E-1367111IPR001005SANT/Myb domain
CDDcd001674.20E-969109No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEETLIIE LHAVLGNRWS QIAAQLPGRT DNEIKNLWNS CLKKKLRQRG  120
IDPVTHKPLS EVENGEEDKT RSQELSNELN LLNSESFKSD EGSYEQRASS SIAPKAYEME  180
GSCSSKINTT KNDTNLMSNC SNKDMFLDSY TTSCQPSDLM GNYPLQITDT LPTNSNSCHW  240
FSQTARPFDM NSEFTITSNV MSILPPTTTS FLPSTSFCYK PSLGVPSEDI STASFALNGP  300
NYWEASASNN SNGSNNTSDG SRELTTTSSK NSVLSSWGLT EETKWSEYLQ NPMLMLAAPE  360
SLCNQIRPAT HLVPDNTLGS IIVPDSKEQQ QQQQSQNSSI FSKDMQKLTA AFGHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-29121165108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1111117LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0973260.0BT097326.1 Soybean clone JCVI-FLGm-21J24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242243.10.0MYB transcription factor MYB64
TrEMBLA0A0B2SGD10.0A0A0B2SGD1_GLYSO; Transcription factor MYB86
STRINGGLYMA19G41010.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.31e-94myb domain protein 55
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]